PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_21610V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 401aa    MW: 43947.2 Da    PI: 5.4291
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_21610V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-181461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT+eEd++lv  ++q+G g+W+t +++ g++R++k+c++rw +yl
  Pp3c1_21610V3.1.p 14 RGPWTPEEDDKLVTWIAQYGAGSWRTLPKRAGLRRCGKSCRLRWTNYL 61
                       89********************************************97 PP

2Myb_DNA-binding47.44.4e-1568110246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        gr+++ E++l+v++++ lG++ W++Ia+ ++ gRt++++k++w++
  Pp3c1_21610V3.1.p  68 GRFSEYEEQLIVHLHATLGSR-WSLIAAQLP-GRTDNDVKNYWNS 110
                        89*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.892965IPR017930Myb domain
SuperFamilySSF466891.3E-2812108IPR009057Homeodomain-like
SMARTSM007173.2E-141363IPR001005SANT/Myb domain
PfamPF002496.3E-161461IPR001005SANT/Myb domain
CDDcd001672.76E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2465116IPR009057Homeodomain-like
SMARTSM007173.7E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129419.18166116IPR017930Myb domain
PfamPF002491.1E-1368110IPR001005SANT/Myb domain
CDDcd001671.07E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MGRAPCCEND TVKRGPWTPE EDDKLVTWIA QYGAGSWRTL PKRAGLRRCG KSCRLRWTNY  60
LRPDLKHGRF SEYEEQLIVH LHATLGSRWS LIAAQLPGRT DNDVKNYWNS RLKRKLCEMG  120
IDPITHKPIS QLLADLAGSE ALLQGGEVAE AALGCFKDDM LDILIRQRSE GSDIDQSAGT  180
HELTTRQPPL MFAASRSCVL QSDPVGANVR STITNDRHNS TFTSRNFEWA VVDDNNYSLA  240
KSTQTNEVQQ YGEVMNSREG SNSQNLAVPS CRLFPQDTAS EGSKFSTTAC NLSSLESPIL  300
VNAPTTVTNL LCDPLAVSWS CHIQDMQRES ITGCVSGIQD LAGRVTVLGS SSLPSPCHSD  360
HSSTTSGITS LVNGDVEGLE TVFSSDVFLW DFPELSCILS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29141167108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S257_83V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-84myb domain protein 103